missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
UbcH5a/UBE2D1 Monoclonal antibody specifically detects UbcH5a/UBE2D1 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), ELISA
Specifications
Specifications
| Antigen | UbcH5a/UBE2D1 |
| Applications | Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin), Sandwich ELISA |
| Classification | Monoclonal |
| Clone | 2C6 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_003329 |
| Gene Alias | E2(17)KB1, Stimulator of Fe transportUBC4/5 homolog, UBC4/5, UBC5A, UbcH5, UbcH5A, UBCH5AEC 6.3.2.19, UBCH5SFT, Ubiquitin carrier protein D1, ubiquitin-conjugating enzyme E2 D1, Ubiquitin-conjugating enzyme E2(17)KB 1, Ubiquitin-conjugating enzyme E2-17 kDa 1, ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D1 |
| Host Species | Mouse |
| Immunogen | UBE2D1 (NP_003329, 1 a.a. ~ 94 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAYQGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWS |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?