U2AF1L4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-55898-25ul

Product Code. 18629486

Description

U2AF1L4 Polyclonal specifically detects U2AF1L4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: U2AF1L4
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: FLJ35525, MGC33901, splicing factor U2AF 26 kDa subunit, U2 auxiliary factor 26, U2 small nuclear RNA auxiliary factor 1-like 3, U2 small nuclear RNA auxiliary factor 1-like 4, U2 small nuclear RNA auxiliary factor 1-like protein 3, U2 small nuclear RNA auxiliary factor 1-like protein 4, U2(RNU2) small nuclear RNA auxiliary factor 1-like 3, U2(RNU2) small nuclear RNA auxiliary factor 1-like protein 3, U2AF1L3, U2AF1L3V1, U2AF1-like protein 3, U2AF1RS3, U2AF1-RS3, U2af26
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 199746
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: U2AF1L4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PRGSILATIPERGTIGVPLITGMAASEALAPLPFTPNRDRCSWQDLSSKP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only