missing translation for 'onlineSavingsMsg'
Learn More
Learn More
U11/U12-35K Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | U11/U12-35K |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
U11/U12-35K Polyclonal specifically detects U11/U12-35K in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| U11/U12-35K | |
| Polyclonal | |
| Purified | |
| RUO | |
| HM1, HM-1, MGC138160, Protein HM-1, small nuclear ribonucleoprotein 35kDa (U11/U12), U1 snRNP-binding protein homolog, U11/U12 small nuclear ribonucleoprotein 35 kDa protein, U11/U12 snRNP 35 kDa protein, U11/U12 snRNP 35K, U11/U12-35K, U1-snRNP binding protein homolog, U1SNRNPBPU1 snRNP binding protein homolog | |
| SNRNP35 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Q5XKN9 | |
| 11066 | |
| Synthetic peptides corresponding to U11/U12-35K The peptide sequence was selected from the N terminal of U11/U12-35K. Peptide sequence RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title