Tyrosylprotein Sulfotransferase 2/TPST2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-60025

Product Code. 18231904

Description

Tyrosylprotein Sulfotransferase 2/TPST2 Polyclonal specifically detects Tyrosylprotein Sulfotransferase 2/TPST2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Tyrosylprotein Sulfotransferase 2/TPST2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.8.2.20, TPST-2, tyrosylprotein phosphotransferase 2, tyrosylprotein sulfotransferase 2protein-tyrosine sulfotransferase 2, tyrosylprotein sulfotransferase-2
• Host Species: Rabbit
• Molecular Weight of Antigen: 42 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O60704
• Gene Symbols: TPST2
• Immunogen: Synthetic peptides corresponding to TPST2(tyrosylprotein sulfotransferase 2) The peptide sequence was selected from the middle region of TPST2. Peptide sequence KAIEVMYAQCMEVGKEKCLPVYYEQLVLHPRRSLKLILDFLGIAWSDAVL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8459
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only