TXNDC12 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-93457-0.1ml

Product Code. 18667241

Description

TXNDC12 Polyclonal antibody specifically detects TXNDC12 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: TXNDC12
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:100, Immunohistochemistry-Paraffin
• Gene Alias: AG1, AGR1, anterior gradient homolog 1, EC 1.8.4.2, endoplasmic reticulum protein ERp19, Endoplasmic reticulum resident protein 18, Endoplasmic reticulum resident protein 19, endoplasmic reticulum thioredoxin superfamily member, 18 kDa, ER protein 18, ER protein 19, ERP16, ERp18, ERP18AG1, ERP19, hAG-1, hTLP19, PDIA16, protein disulfide isomerase family A, member 16, thioredoxin domain containing 12 (endoplasmic reticulum), thioredoxin domain-containing protein 12, Thioredoxin-like protein p19, TLP19, TLP19hTLP19, TXNDC12 thioredoxin domain containing 12 (endoplasmic reticulum)
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 93-172 of human TXNDC12 (NP_056997.1). NLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
• Quantity: 0.1 mL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 51060
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified