TXNDC Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-35733-20ul

Product Code. 30229998

Description

TXNDC Polyclonal antibody specifically detects TXNDC in Human samples. It is validated for ELISA,Western Blot

Specifications

• Antigen: TXNDC
• Classification: Polyclonal
• Dilution: Western Blot 1:500 - 1:2000, ELISA
• Gene Alias: DKFZp564E1962, PDIA11, protein disulfide isomerase family A, member 11, thioredoxin domain containing 1, thioredoxin domain-containing, Thioredoxin domain-containing protein 1, thioredoxin-related transmembrane protein 1, TMXTXNDC, Transmembrane Trx-related protein, TXNDC1thioredoxin domain containing
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human TXNDC (NP_110382.3).,, Sequence:, KRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
• Quantity: 20 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 81542
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified