missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TXNDC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35733-100ul
This item is not returnable.
View return policy
Description
TXNDC Polyclonal antibody specifically detects TXNDC in Human samples. It is validated for ELISA,Western Blot
Specifications
| TXNDC | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| DKFZp564E1962, PDIA11, protein disulfide isomerase family A, member 11, thioredoxin domain containing 1, thioredoxin domain-containing, Thioredoxin domain-containing protein 1, thioredoxin-related transmembrane protein 1, TMXTXNDC, Transmembrane Trx-related protein, TXNDC1thioredoxin domain containing | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 210-280 of human TXNDC (NP_110382.3).,, Sequence:, KRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS | |
| 100 μL | |
| Signal Transduction | |
| 81542 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction