missing translation for 'onlineSavingsMsg'
Learn More

TWEAK R/TNFRSF12 Rabbit anti-Human, Mouse, Rat, Clone: 1G4T3, Novus Biologicals™

Product Code. 18386806 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18386806 20 μg 20µL
18394633 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18386806 Supplier Novus Biologicals Supplier No. NBP31662120UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Monoclonal Antibody

TWEAK R/TNFRSF12 Monoclonal antibody specifically detects TWEAK R/TNFRSF12 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen TWEAK R/TNFRSF12
Applications Western Blot, Immunofluorescence
Classification Monoclonal
Clone 1G4T3
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias CD266, CD266 antigen, FGF-inducible 14, Fibroblast growth factor-inducible immediate-early response protein 14, FN14tumor necrosis factor receptor superfamily member 12A, tumor necrosis factor receptor superfamily, member 12A, TweakR, Tweak-receptor, type I transmembrane protein Fn14
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-129 of human TWEAK R/TNFRSF12 (Q9NP84). MDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Angiogenesis, Apoptosis, Biologically Active Proteins, Cancer, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 51330
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.