missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TUT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | TUT1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18246684
|
Novus Biologicals
NBP2-57861 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18628658
|
Novus Biologicals
NBP2-57861-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TUT1 Polyclonal specifically detects TUT1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| TUT1 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 64852 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LASPQSLPPASPLLEDREEGDLGKASELAETPKEEKAEGAAMLELVGSILRGCVPGVYRVQTVPSARRPVVKFCHRPSGLHGD | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| EC 2.7.7.19, EC 2.7.7.52, FLJ21850, FLJ22267, FLJ22347, MGC131987, MGC149809, nuclear speckle targeted phosphatidylinositol 4-phosphate 5-kinase type I-alpharegulated-poly(A) polymerase, nuclear speckle-targeted PIPK1A-regulated-poly(A) polymerase, PAP-associated domain-containing 2, PAPD2, poly(A) polymerase associated domain containing 2, RBM21, RNA binding motif protein 21, RNA uridylyltransferase, RNA-binding motif protein 21, RNA-binding protein 21, speckle targeted PIP5K1A-regulated poly(A) polymerase, star-PAP, STARPAP, terminal uridylyl transferase 1, U6 snRNA-specific, TUTase, U6 snRNA-specific terminal uridylyltransferase 1, U6 TUTase, U6-TUTase | |
| TUT1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title