missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TTC6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TTC6 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TTC6 Polyclonal specifically detects TTC6 in Human samples. It is validated for Western Blot.Specifications
| TTC6 | |
| Polyclonal | |
| Rabbit | |
| Q86TZ1 | |
| 319089 | |
| Synthetic peptides corresponding to TTC6(tetratricopeptide repeat domain 6) The peptide sequence was selected from the C terminal of TTC6. Peptide sequence MKDYQDAITLNPKYSLAYFNAGNIYFHHRQFSQASDYFSKALKFDPENEY. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C14orf25, NCRNA00291, TTC6 tetratricopeptide repeat domain 6 | |
| TTC6 | |
| IgG | |
| 59 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title