missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSSK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-83883
This item is not returnable.
View return policy
Description
TSSK1 Polyclonal specifically detects TSSK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| TSSK1 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| EC 2.7.11, serine/threonine kinase 22D (spermiogenesis associated), Serine/threonine-protein kinase 22A, spermiogenesis associated 4, SPOGA1, SPOGA4EC 2.7.11.1, STK22A, STK22DFKSG81, Testis-specific kinase 1, testis-specific serine kinase 1, testis-specific serine kinase 1B, testis-specific serine/threonine-protein kinase 1, TSK-1, TSSK-1, TSSK1serine/threonine kinase FKSG81 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| TSSK1B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETR | |
| 0.1 mL | |
| Protein Kinase | |
| 83942 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction