TSSC3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-59088

Product Code. 18264464

Description

TSSC3 Polyclonal specifically detects TSSC3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TSSC3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein, BWR1Cp17-Beckwith-Wiedemann region 1 C, HLDA2BRW1C, Imprinted in placenta and liver protein, IPLp17-BWR1C, pleckstrin homology-like domain family A member 2, pleckstrin homology-like domain, family A, member 2, TSSC3p17-Beckwith-Wiedemann region 1C, tumor suppressing subchromosomal transferable fragment cDNA 3, tumor suppressing subtransferable candidate 3, Tumor-suppressing STF cDNA 3 protein, Tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein, tumor-supressing STF cDNA 3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: Q53GA4
• Gene Symbols: PHLDA2
• Immunogen: Synthetic peptides corresponding to PHLDA2(pleckstrin homology-like domain, family A, member 2) The peptide sequence was selected from the middle region of PHLDA2. Peptide sequence QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT.
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 7262
• Target Species: Human
• Isotype: IgG

For Research Use Only