missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSR1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TSR1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TSR1 Polyclonal specifically detects TSR1 in Human samples. It is validated for Western Blot.Specifications
| TSR1 | |
| Polyclonal | |
| Rabbit | |
| Q2NL82 | |
| 55720 | |
| Synthetic peptides corresponding to TSR1(TSR1, 20S rRNA accumulation, homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of TSR1. Peptide sequence MALVATVYAPITFPPASVLLFKQKSNGMHSLIATGHLMSVDPDRMVIKRV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ10534, KIAA1401, MGC131829, pre-rRNA-processing protein TSR1 homolog, TSR1, 20S rRNA accumulation, homolog (S. cerevisiae), TSR1, 20S rRNA accumulation, homolog (yeast) | |
| TSR1 | |
| IgG | |
| 92 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title