missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSPYL4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TSPYL4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TSPYL4 Polyclonal specifically detects TSPYL4 in Human samples. It is validated for Western Blot.Specifications
| TSPYL4 | |
| Polyclonal | |
| Rabbit | |
| Q9UJ04 | |
| 23270 | |
| Synthetic peptides corresponding to TSPYL4(TSPY-like 4) The peptide sequence was selected from the middle region of TSPYL4. Peptide sequence QKEKKVAGGVKEETRPRAPKINNCMDSLEAIDQELSNVNAQADRAFLQLE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| KIAA0721dJ486I3.2, testis-specific Y-encoded-like protein 4, TSPY-like 4, TSPY-like protein 4 | |
| TSPYL4 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title