missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TSPAN8/TM4SF3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

TSPAN8/TM4SF3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18349942 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18349942 100 μg 100µL
18346416 25 μg 25µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18349942 Supplier Novus Biologicals Supplier No. NBP317777100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Beschreibung

Rabbit Polyclonal Antibody

TSPAN8/TM4SF3 Polyclonal antibody specifically detects TSPAN8/TM4SF3 in Human samples. It is validated for Immunofluorescence
TRUSTED_SUSTAINABILITY

Spezifikation

Antigen TSPAN8/TM4SF3
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias CO-029, tetraspanin 8, TM4SF3tspan-8, Transmembrane 4 superfamily member 3tetraspanin-8, Tspan-8, Tumor-associated antigen CO-029
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: IVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVY
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 7103
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Mehr anzeigen Weniger anzeigen
Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.