missing translation for 'onlineSavingsMsg'
Learn More

TSPAN7/TM4SF2 Antibody, Novus Biologicals™

Product Code. 18433642 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18433642 25 μL 25µL
18786653 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18433642 Supplier Novus Biologicals Supplier No. NBP19031025ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody has been used in 4 publications

TSPAN7/TM4SF2 Polyclonal specifically detects TSPAN7/TM4SF2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TSPAN7/TM4SF2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias A15CCG-B7, CD231, CD231 antigen, Cell surface glycoprotein A15, Membrane component chromosome X surface marker 1, mental retardation, X-linked 58, MRX58, MXS1T-cell acute lymphoblastic leukemia associated antigen 1, T-cell acute lymphoblastic leukemia-associated antigen 1, tetraspanin 7, tetraspanin-7, TM4SF2tetraspanin protein, transmembrane 4 superfamily 2b, Transmembrane 4 superfamily member 2X chromosome, surface marker 1, transmembrane protein A15, Tspan-7
Gene Symbols TSPAN7
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:TFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMET
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline metabolism
Primary or Secondary Primary
Gene ID (Entrez) 7102
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.