missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TSPAN32/TSSC6 Monoclonal antibody specifically detects TSPAN32/TSSC6 in Human samples. It is validated for ELISA,Western Blot
Specifications
Specifications
| Antigen | TSPAN32/TSSC6 |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Clone | 2G12 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Alias | ART1, FLJ17158, FLJ97586, MGC22455, pan-hematopoietic expression, PHEMXPHMX, Protein Phemx, tetraspanin 32, tetraspanin-32, tspan-32, TSSC6pan-hematopoietic expression protein, tumor-suppressing STF cDNA 6, tumor-suppressing subchromosomal transferable fragment cDNA 6, tumor-suppressing subtransferable candidate 6 |
| Host Species | Mouse |
| Immunogen | TSPAN32 (NP_005696, 194 a.a. ∽ 290 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RCGCSLDRKGKYTLTPRACGRQPQEPSLLRCSQGGPTHCLHSEAVAIGPRGCSGSLRWLQESDAAPLPLSCHLAAHRALQGRSRGGLSGCPERGLSD |
| Purification Method | IgG purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?