missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ TSPAN17 Recombinant Protein Antigen
Shop All Bio Techne Products
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TSPAN17. Source: E.coli Amino Acid Sequence: NDWNLNIYFNCTDLNPSRERCGVPFSCCVRDPAEDVLNTQCGYDVRLKLELEQQGFIHTKGCVGQFEKWL The TSPAN17 Recombinant Protein Antigen is derived from E. coli. The TSPAN17 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Specifications
Specifications
| Gene ID (Entrez) | 26262 |
| Purification Method | >80% by SDS-PAGE and Coomassie blue staining |
| Common Name | TSPAN17 Recombinant Protein Antigen |
| Content And Storage | Store at −20°C. Avoid freeze-thaw cycles |
| Formulation | PBS and 1M Urea, pH 7.4 |
| For Use With (Application) | Blocking/Neutralizing, Control |
| Gene Alias | F-box only protein 23, FBXO23, MGC14859, MGC71255, Tetraspan protein SB134, tetraspanin 17, tetraspanin-17, TM4SF17, transmembrane 4 superfamily member 17, Tspan-17 |
| Gene Symbol | TSPAN17 |
| Label Type | Unlabeled |
| Product Type | Recombinant Protein Antigen |
| Show More |
For research use only.
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction