TSPAN16 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-16969-25UL

Product Code. 18356296

Description

TSPAN16 Polyclonal antibody specifically detects TSPAN16 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: TSPAN16
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 26526
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQS
• Quantity: 25 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified