missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSPAN13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£342.00 - £443.00
Specifications
| Antigen | TSPAN13 |
|---|---|
| Concentration | 0.1mg/mL |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:500 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18450391
|
Novus Biologicals
NBP1-81001-25ul |
25ul |
£342.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18298736
|
Novus Biologicals
NBP1-81001 |
0.1 mL |
£443.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TSPAN13 Polyclonal specifically detects TSPAN13 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| TSPAN13 | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:10-1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| FLJ22934, NET-6, NET6transmembrane 4 superfamily member tetraspan NET-6, Tetraspan NET-6, tetraspanin 13, TM4SF13, Transmembrane 4 superfamily member 13tetraspanin-13, Tspan-13 | |
| TSPAN13 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| 0.1mg/mL | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 27075 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:ACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEV | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title