missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSGA13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TSGA13 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TSGA13 Polyclonal specifically detects TSGA13 in Human samples. It is validated for Western Blot.Specifications
| TSGA13 | |
| Polyclonal | |
| Rabbit | |
| testis specific, 13, testis-specific A13 | |
| TSGA13 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 114960 | |
| Synthetic peptides corresponding to TSGA13(testis specific, 13) The peptide sequence was selected from the middle region of TSGA13. Peptide sequence ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title