missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TSGA10IP Polyclonal specifically detects TSGA10IP in Human samples. It is validated for Western Blot.
Specifications
Specifications
| Antigen | TSGA10IP |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | FAM161C, FLJ32880, MGC120465, MGC120466, MGC120468, testis specific, 10 interacting protein, testis-specific protein 10-interacting protein, Tsga10-interacting protein |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human TSGA10IP. Peptide sequence GHQALPMPSSFSQRQSRRKSTANLPEAHGCCWKTEAQNLKARQQLGAWGG |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?