TSBP Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP3-17554-100UL

Code produit. 18372867

Description

TSBP Polyclonal antibody specifically detects TSBP in Human samples. It is validated for Immunofluorescence

Spécification

• Antigen: TSBP
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: C6orf10, chromosome 6 open reading frame 10, testis specific basic protein, TSBP
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ILTGYMDEELAKKSCSKIQILKCGGTARSQNSREENKEALKNDIIFTNSVESLKSAHIKEPEREGKGTDLEKDKIGMEVKVDSDAGIP
• Quantity: 100 μg
• Research Discipline: Cell Biology
• Gene ID (Entrez): 10665
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified