missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Tryptophanyl tRNA synthetase Rabbit anti-Human, Mouse, Rat, Clone: 3B2F10, Novus Biologicals™

Tryptophanyl tRNA synthetase Rabbit anti-Human, Mouse, Rat, Clone: 3B2F10, Novus Biologicals™

Product Code. 18341113
Change view
Click to view available options
Quantity:
100 μg
20 μg
Unit Size:
100µL
20µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18341113 100 μg 100µL
18081334 20 μg 20µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18341113 Supplier Novus Biologicals Supplier No. NBP316419100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

Tryptophanyl tRNA synthetase Monoclonal antibody specifically detects Tryptophanyl tRNA synthetase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Tryptophanyl tRNA synthetase
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 3B2F10
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias EC 6.1.1, EC 6.1.1.2, GAMMA-2, hWRS, IFI53, IFP53trpRS, Interferon-induced protein 53, TrpRS, tryptophan tRNA ligase 1, cytoplasmic, Tryptophan--tRNA ligase, tryptophanyl-tRNA synthetase, tryptophanyl-tRNA synthetase, cytoplasmic, WRS
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 3-98 of human Tryptophanyl tRNA synthetase (P23381). NSEPASLLELFNSIATQGELVRSLKAGNASKDEIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDFVDPWTVQTSSAKGI
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 7453
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.