missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tryptase gamma-1/TPSG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-37977-25ul
This item is not returnable.
View return policy
Description
Tryptase gamma-1/TPSG1 Polyclonal specifically detects Tryptase gamma-1/TPSG1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| Tryptase gamma-1/TPSG1 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q9NRR2 | |
| TPSG1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| EC 3.4.21, EC 3.4.21.-, gamma I, gamma II, lung tryptase, mast cell protease II, mast cell tryptase, PRSS31skin tryptase, Serine protease 31, TMTpituitary tryptase, Transmembrane tryptase, trpA, tryptase gamma, tryptase gamma 1, tryptase gamma I, tryptase gamma II | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 25823 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction