Tryptase gamma-1/TPSG1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-37977

Product Code. 18162158

Description

Tryptase gamma-1/TPSG1 Polyclonal specifically detects Tryptase gamma-1/TPSG1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Tryptase gamma-1/TPSG1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9NRR2
• Gene Symbols: TPSG1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCAR
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.4.21, EC 3.4.21.-, gamma I, gamma II, lung tryptase, mast cell protease II, mast cell tryptase, PRSS31skin tryptase, Serine protease 31, TMTpituitary tryptase, Transmembrane tryptase, trpA, tryptase gamma, tryptase gamma 1, tryptase gamma I, tryptase gamma II
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 25823
• Target Species: Human
• Isotype: IgG