missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18258031

Novus Biologicals™ TRUB1 Recombinant Protein Antigen

Artikelnummer. 18258031 Shop alle Bio Techne produkter
Klik for at se tilgængelige muligheder
Quantity:
100 μL
Pakningsstørrelse:
100µL
Denne vare kan ikke returneres. Se returpolicy

Artikelnummer. 18258031

Brand: Novus Biologicals™ NBP255729PEP

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRUB1. Source: E.coli Amino Acid Sequence: KLLSLSGVFAVHKPKGPTSAELLNRLKEKLLAEAGMPSPEWTKRKKQTLKIGHGGTLDSAARGVLVVGIGSGTKMLTSMLSGSKRYTAIGELGK The TRUB1 Recombinant Protein Antigen is derived from E. coli. The TRUB1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Tekniske data

Gene ID (Entrez) 142940
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name TRUB1 Recombinant Protein Antigen
Content And Storage Store at −20C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias EC 5.4.99, EC 5.4.99.-, PUS4probable tRNA pseudouridine synthase 1, TruB pseudouridine (psi) synthase homolog 1 (E. coli)
Gene Symbol TRUB1
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52185. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Vis mere Vis mindre

For Research Use Only

Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.