missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRPM3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£378.00
Specifications
| Antigen | TRPM3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
TRPM3 Polyclonal specifically detects TRPM3 in Human samples. It is validated for Western Blot.Specifications
| TRPM3 | |
| Polyclonal | |
| Purified | |
| RUO | |
| EC 2.3.1.31, EC 5.99.1.3, Long transient receptor potential channel 3, LTrpC3, LTrpC-3, LTRPC3KIAA1616MLSN2GON-2, melastatin 2, melastatin-2, transient receptor potential cation channel subfamily M member 3, transient receptor potential cation channel, subfamily M, member 3 | |
| TRPM3 | |
| IgG | |
| Protein A purified |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| AAH94699 | |
| 80036 | |
| Synthetic peptide directed towards the N terminal of human TRPM3. Peptide sequence YLRDTPPVPVVVCDGSGRASDILAFGHKYSEEGGLINESLRDQLLVTIQK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title