missing translation for 'onlineSavingsMsg'
Learn More

TRPC5 Antibody (1C8), Novus Biologicals™

Product Code. 18320898 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18320898 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18320898 Supplier Novus Biologicals Supplier No. H00007224M10

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

TRPC5 Monoclonal antibody specifically detects TRPC5 in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen TRPC5
Applications Western Blot, ELISA
Classification Monoclonal
Clone 1C8
Conjugate Unconjugated
Dilution Western Blot, ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_036603
Gene Alias hTRP5, hTRP-5, short transient receptor potential channel 5, transient receptor potential cation channel, subfamily C, member 5, Transient receptor protein 5, TRP-5, TRP5transient receptor potential channel 5, TrpC5
Host Species Mouse
Immunogen TRPC5 (NP_036603, 534 a.a. ~ 603 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GLNQLYFYYETRAIDEPNNCKGIRCEKQNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGAT
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer
Primary or Secondary Primary
Gene ID (Entrez) 7224
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.