missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18350248

TRPC1 Antibody (1E4), Novus Biologicals™

Product Code. 18350248 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
50 μg
Unit Size:
50µg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18350248 50 μg 50µg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18350248 Supplier Novus Biologicals Supplier No. H00007220M0350ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

TRPC1 Monoclonal antibody specifically detects TRPC1 in Human samples. It is validated for ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen TRPC1
Applications ELISA
Classification Monoclonal
Clone 1E4
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_003295
Gene Alias HTRP-1, MGC133334, MGC133335, transient receptor potential canonical 1, transient receptor potential cation channel, subfamily C, member 1, transient receptor potential channel 1, Transient receptor protein 1, TRP-1, TRP1short transient receptor potential channel 1, TrpC1
Host Species Mouse
Immunogen TRPC1 (NP_003295, 442 a.a. ~ 505 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AHNKFHDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGK
Purification Method Protein A or G purified
Quantity 50 μg
Regulatory Status RUO
Research Discipline Cardiovascular Biology, Neuroscience, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 7220
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.