missing translation for 'onlineSavingsMsg'
Learn More

TRPA1 Antibody (6G8), Novus Biologicals™

Product Code. 18365868 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18365868 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18365868 Supplier Novus Biologicals Supplier No. H00008989M03

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

TRPA1 Monoclonal antibody specifically detects TRPA1 in Human, Mouse, Guinea Pig samples. It is validated for Western Blot, ELISA, Immunohistochemistry
TRUSTED_SUSTAINABILITY

Specifications

Antigen TRPA1
Applications Western Blot, ELISA, Immunohistochemistry
Classification Monoclonal
Clone 6G8
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_015628
Gene Alias ANKTM1ankyrin-like with transmembrane domains 1, Ankyrin-like with transmembrane domains protein 1, Transformation-sensitive protein p120, transient receptor potential cation channel subfamily A member 1, transient receptor potential cation channel, subfamily A, member 1
Host Species Mouse
Immunogen TRPA1 (NP_015628, 1033 a.a. ~ 1117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IPNADKSLEMEILKQKYRLKDLTFLLEKQHELIKLIIQKMEIISETEDDDSHCSFQDRFKKEQMEQRNSRWNTVLRAVKAKTHHL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Neuronal Cell Markers, Neuroscience, Neurotransmission, Sensory Systems
Primary or Secondary Primary
Gene ID (Entrez) 8989
Target Species Human, Mouse, Guinea Pig
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.