TRP7 Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-94388-0.02ml

Product Code. 18686842

Description

TRP7 Polyclonal antibody specifically detects TRP7 in Human, Mouse samples. It is validated for Western Blot

Specifications

• Antigen: TRP7
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: hTRP7, KNP3, likley ortholog of mouse transient receptor potential cation channel, subfamilyC, member 7, putative capacitative calcium channel, short transient receptor potential channel 7, transient receptor potential cation channel, subfamily C, member 7, transient receptor potential-related channel 7, a novel putative Ca2+ channelprotein10TRPM2, Transient receptor protein 7, TRP7, TRP-7, TrpC7
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 720-780 of human TRPC7 (NP_065122.1). YLIMRIKMCLIKLCKSKAKSCENDLEMGMLNSKFKKTRYQAGMRNSENLTANNTLSKPTRY
• Quantity: 0.02 mL
• Research Discipline: Neuroscience, Signal Transduction
• Gene ID (Entrez): 57113
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.3), 50% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified