missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Tropomodulin 3 Antibody (1E1), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00029766-M10
This item is not returnable.
View return policy
Description
Tropomodulin 3 Monoclonal antibody specifically detects Tropomodulin 3 in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, ELISA
Specifications
| Tropomodulin 3 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| tropomodulin 3 (ubiquitous), tropomodulin-3, Ubiquitous tropomodulin, U-Tmod, UTMOD | |
| TMOD3 (NP_055362, 280 a.a. ~ 352 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RDNETLAELKIDNQRQQLGTAVELEMAKMLEENTNILKFGYQFTQQGPRTRAANAITKNNDLVRKRRVEGDHQ | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Immunocytochemistry, Sandwich ELISA | |
| 1E1 | |
| Western Blot 1:500 | |
| NP_055362 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 29766 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction