missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TrkB Rabbit anti-Human, Polyclonal, Novus Biologicals™
Description
TrkB Polyclonal antibody specifically detects TrkB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | TrkB |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | BDNF/NT-3 growth factors receptor, EC 2.7.10, EC 2.7.10.1, GP145-TrkB, Neurotrophic tyrosine kinase receptor type 2, neurotrophic tyrosine kinase, receptor, type 2, trk-B, TrkB tyrosine kinase, TRKBBDNF-tropomyosine receptor kinase B, tyrosine kinase receptor B |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: INFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPS |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?