missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TrkB Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-16988-100UL
This item is not returnable.
View return policy
Description
TrkB Polyclonal antibody specifically detects TrkB in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| TrkB | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| BDNF/NT-3 growth factors receptor, EC 2.7.10, EC 2.7.10.1, GP145-TrkB, Neurotrophic tyrosine kinase receptor type 2, neurotrophic tyrosine kinase, receptor, type 2, trk-B, TrkB tyrosine kinase, TRKBBDNF-tropomyosine receptor kinase B, tyrosine kinase receptor B | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: INFTRNKLTSLSRKHFRHLDLSELILVGNPFTCSCDIMWIKTLQEAKSSPDTQDLYCLNESSKNIPLANLQIPNCGLPS | |
| 100 μg | |
| Neuroendocrinology, Oncogenes, Protein Kinase, Signal Transduction | |
| 4915 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction