missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | TRIT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TRIT1 Polyclonal specifically detects TRIT1 in Human samples. It is validated for Western Blot.Specifications
| TRIT1 | |
| Polyclonal | |
| Rabbit | |
| NP_060116 | |
| 54802 | |
| Synthetic peptide directed towards the middle region of human TRIT1. Peptide sequence PHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILW. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 2.5.1.75, EC 2.5.1.8, FLJ20061, hGRO1, IPP transferase, IPTase, IPTMGC149243, MGC149242, mitochondrial, MOD5, tRNA isopentenylpyrophosphate transferase, tRNA isopentenyltransferase, tRNA isopentenyltransferase 1 | |
| TRIT1 | |
| IgG | |
| 51 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title