missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£231.00 - £470.00
Specifications
| Antigen | TRIP1 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18417840
|
Novus Biologicals
NBP1-84874-25ul |
25ul |
£231.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18215448
|
Novus Biologicals
NBP1-84874 |
0.1 mL |
£470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TRIP1 Polyclonal specifically detects TRIP1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| TRIP1 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Mouse, Rat | |
| eIF-3-beta, eIF3-beta, eIF3i, eIF3-p36, EIF3S2TGF-beta receptor-interacting protein 1, Eukaryotic translation initiation factor 3 subunit 2, eukaryotic translation initiation factor 3 subunit I, eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD), eukaryotic translation initiation factor 3, subunit 2 beta, 36kDa, eukaryotic translation initiation factor 3, subunit I, predicted protein of HQ2242, TGFbeta receptor-interacting protein 1, TRIP-1, TRIP-1eIF3 p36, TRIP1PRO2242 | |
| EIF3I | |
| IgG | |
| Affinity Purified | |
| Specificity of human TRIP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Cancer, Core ESC Like Genes, Stem Cell Markers | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 8668 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MGYQCFVSFFDLRDPSQIDNNEPYMKIPCNDSKITSAVWGPLGECIIAGHESGELNQYSAKSGEVLVNVKEHSRQINDIQLSRD | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title