missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TRIM8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

TRIM8 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Product Code. 18338935 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18338935 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18338935 Supplier Novus Biologicals Supplier No. NBP310336100UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TRIM8 Polyclonal specifically detects TRIM8 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TRIM8
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias EC 6.3.2.-, GERP, GERPRING finger protein 27glioblastoma expressed ring finger protein, Glioblastoma-expressed RING finger protein, RNF27probable E3 ubiquitin-protein ligase TRIM8, tripartite motif containing 8, tripartite motif protein TRIM8, tripartite motif-containing 8, Tripartite motif-containing protein 8
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TRIM8 (NP_112174). Peptide sequence QSVPLYPCGVSSSGAEKRKHSTAFPEASFLETSSGPVGGQYGAAGTASGE
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 81603
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.