TRIM60 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49338-25ul

Product Code. 18659508

Description

TRIM60 Polyclonal antibody specifically detects TRIM60 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: TRIM60
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: FLJ35882, RING finger protein 129MGC119325, RING finger protein 33, RNF129, RNF33, tripartite motif containing 60, tripartite motif-containing 60, tripartite motif-containing protein 60
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VGNKPKWILGVCQDCLLRNWQDQPSVLGGFWAIGRYMKSGYVASGPKTTQLLPVVKPSK
• Quantity: 25 μL
• Research Discipline: Zinc Finger
• Gene ID (Entrez): 166655
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified