missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIM56 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£386.00
Specifications
| Antigen | TRIM56 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
TRIM56 Polyclonal specifically detects TRIM56 in Human samples. It is validated for Western Blot.Specifications
| TRIM56 | |
| Polyclonal | |
| Rabbit | |
| Zinc Finger | |
| DKFZp667O116, E3 ubiquitin-protein ligase TRIM56, EC 6.3.2.-, RING finger protein 109, RNF109FLJ35608, tripartite motif containing 56, tripartite motif-containing 56, Tripartite motif-containing protein 56 | |
| TRIM56 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_112223 | |
| 81844 | |
| Synthetic peptide directed towards the middle region of human TRIM56. Peptide sequence DPKGSLLGDFLTAYHGLEKPRVTTMVDGRYLVVSLSNGTIHIFRVRSPDS. | |
| Primary |
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts