missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beskrivning
TRIM5 Polyclonal antibody specifically detects TRIM5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifikationer
Specifikationer
| Antigen | TRIM5 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | EC 6.3.2, EC 6.3.2.-, RING finger protein 88, RNF88tripartite motif protein TRIM, TRIM5alpha, tripartite motif containing 5, tripartite motif protein TRIM5, tripartite motif-containing 5, tripartite motif-containing protein 5 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQS |
| Purification Method | Immunogen affinity purified |
| Visa mer |
Produkttitel
Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.
Hittar du en möjlighet till förbättring?