missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. TRIM46 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

TRIM46 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Product Code. 18381584 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μg
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18381584 25 μg 25µL
18320866 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18381584 Supplier Novus Biologicals Supplier No. NBP31016225UL

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

TRIM46 Polyclonal specifically detects TRIM46 in Mouse samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen TRIM46
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS buffer, 2% sucrose
Gene Alias FLJ23229, Gene Y protein, GeneY, TRIFICGENEY, tripartite motif containing 46, tripartite motif-containing 46, tripartite motif-containing protein 46, Tripartite, fibronectin type-III and C-terminal SPRY motif protein
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse TRIM46 (NP_898858.1). Peptide sequence ASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSGHDSGAEDAAVEALPP
Purification Method Affinity purified
Quantity 25 μg
Regulatory Status RUO
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 80128
Target Species Mouse
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.