TRIM3/BERP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-48897

Product Code. 18650726

Description

TRIM3/BERP Polyclonal antibody specifically detects TRIM3/BERP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: TRIM3/BERP
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: BERPRING finger protein 97, Brain-expressed RING finger protein, HAC1, RING finger protein 22, RNF22brain expressed ring finger, RNF97FLJ16135, tripartite motif containing 3, tripartite motif protein TRIM3, tripartite motif-containing 3, tripartite motif-containing protein 3
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QHKAALQRQLEAVRGRLPQLSAAIALVGGISQQLQERKAEALAQISAAFEDLEQALQQRKQALVSDLETICGAKQKVLQ
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10612
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG