missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TRIF/TICAM1 Polyclonal antibody specifically detects TRIF/TICAM1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | TRIF/TICAM1 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | MGC35334, Proline-rich, vinculin and TIR domain-containing protein B, PRVTIRBTIR domain-containing adapter protein inducing IFN-beta, Putative NF-kappa-B-activating protein 502H, TICAM-1TIR domain containing adaptor inducing interferon-beta, TIR domain-containing adapter molecule 1, TIR domain-containing adaptor molecule 1, toll-like receptor adaptor molecule 1, TRIFToll-interleukin-1 receptor domain-containing adapter protein inducinginterferon beta |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVARLVARQWAGVDSTEDPEEPPDVSWAVARLYHL |
| Purification Method | Immunogen affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?