TRIB3 Antibody (1H2), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00057761-M03

Product Code. 18511860

Description

TRIB3 Monoclonal antibody specifically detects TRIB3 in Human, Mouse samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay, Gene Knock-Out, KnockDown

Specifications

• Antigen: TRIB3
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: C20orf97, dJ1103G7.3, neuronal cell death inducible putative kinase, Neuronal cell death-inducible putative kinase, NIPK, p65-interacting inhibitor of NF-kappaB, p65-interacting inhibitor of NF-kappa-B, SINK, SKIP3, TRB-3, TRB3chromosome 20 open reading frame 97, tribbles homolog 3, tribbles homolog 3 (Drosophila)
• Immunogen: TRIB3 (AAH27484, 56 a.a. ∽ 145 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PDRATAVATASRLGPYVLLEPEEGGRAYRALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRTHGDMH
• Quantity: 0.1 mg
• Research Discipline: Apoptosis, Cancer, Hypoxia
• Gene ID (Entrez): 57761
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG1 κ

• Applications: Western Blot, ELISA, Immunofluorescence, Proximity Ligation Assay, Gene Knock-Out, KnockDown
• Clone: 1H2
• Dilution: Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Proximity Ligation Assay, Knockout Validated, Knockdown Validated
• Gene Accession No.: AAH27484
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified