missing translation for 'onlineSavingsMsg'
Learn More

TRIB2 Antibody (1B1), Novus Biologicals™

Product Code. 18381089 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18381089 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18381089 Supplier Novus Biologicals Supplier No. H00028951M04

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

TRIB2 Monoclonal antibody specifically detects TRIB2 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
TRUSTED_SUSTAINABILITY

Specifications

Antigen TRIB2
Applications Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunohistochemistry (Paraffin), KnockDown
Classification Monoclonal
Clone 1B1
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunohistochemistry 1:10 to 1:500, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin 3 μg/mL, Knockdown Validated
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_067675
Gene Alias C5FW, FLJ57420, GS3955, TRB-2, TRB2tribbles homolog 2, tribbles homolog 2 (Drosophila)
Host Species Mouse
Immunogen TRIB2 (NP_067675, 254 a.a. ~ 343 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. FHDIEPSSLFSKIRRGQFNIPETLSPKAKCLIRSILRREPSERLTSQEILDHPWFSTDFSVSNSAYGAKEVSDQLVPDVNMEENLDPFFN
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 28951
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2b λ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.