TREX1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68672-25ul

Product Code. 18641958

Description

TREX1 Polyclonal antibody specifically detects TREX1 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: TREX1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: 3'-5' exonuclease TREX1, AGS1, Aicardi-Goutieres syndrome 1, CRV, DKFZp434J0310, DNase III, DRN3, EC 3.1.11.2, HERNS, three prime repair exonuclease 1,3' repair exonuclease 1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VDAHARPFGTIRPMYGVTASARTKPRPSAVTTTAHLATTRNTSPSLGESRGTKDLPPVKDPGALSRE
• Quantity: 25 μL
• Research Discipline: DNA Repair, Editing and Processing Endonucleases
• Gene ID (Entrez): 11277
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified