Novus Biologicals Treacher Collins syndrome protein Antibody (8H3), Novus Biologicals™

Mouse Monoclonal Antibody

Brand:  Novus Biologicals H00006949-M02

Product Code. 18450280

Description

Treacher Collins syndrome protein Monoclonal antibody specifically detects Treacher Collins syndrome protein in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: Treacher Collins syndrome protein
• Classification: Monoclonal
• Conjugate: Unconjugated
• Gene Accession No.: NP_001008657
• Host Species: Mouse
• Purification Method: IgG purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot, ELISA, Immunocytochemistry
• Clone: 8H3
• Formulation: In 1x PBS, pH 7.4
• Gene Alias: MFD1, nucleolar trafficking phosphoprotein, TCS1, Treacher Collins syndrome protein, Treacher Collins-Franceschetti syndrome 1, treacle, treacle protein
• Immunogen: TCOF1 (NP_001008657, 2 a.a. ~ 82 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AEARKRRELLPLIYHHLLRAGYVRAAREVKEQSGQKCFLAQPVTLLDIYTHWQQTSELGRKRKAEEDAALQAKKTRVSDPI
• Quantity: 0.1 mg
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 6949
• Content And Storage: Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
• Isotype: IgG1 κ