TRBP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-13411

Product Code. 18185590

Description

TRBP Polyclonal specifically detects TRBP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: TRBP
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Alias: LOQS, RISC-loading complex subunit TARBP2, TAR (HIV) RNA binding protein 2, TAR (HIV) RNA-binding protein 2, TAR (HIV) RNA-binding protein TRBP1, TAR (HIV-1) RNA binding protein 2, TAR RNA binding protein 2, TAR RNA-binding protein 2, trans-activation responsive RNA-binding protein, Trans-activation-responsive RNA-binding protein, TRBP, TRBP1, TRBP2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: TARBP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: TVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPEDIPVFTAAAAAT
• Quantity: 0.1 mL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 6895
• Target Species: Human
• Isotype: IgG

For Research Use Only