missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Trappin-2/Elafin/Skalp Antibody, Novus Biologicals™

Trappin-2/Elafin/Skalp Antibody, Novus Biologicals™

Product Code. 18429211 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
Unit Size:
0.10mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18429211 25 μL 25µL
18293297 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18429211 Supplier Novus Biologicals Supplier No. NBP18569025ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 3 publications

Trappin-2/Elafin/Skalp Polyclonal specifically detects Trappin-2/Elafin/Skalp in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Trappin-2/Elafin/Skalp
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias cementoin, Elastase-specific inhibitor, ESIWAP four-disulfide core domain protein 14, Peptidase inhibitor 3, peptidase inhibitor 3, skin-derived, PI-3, pre-elafin, protease inhibitor 3, skin-derived (SKALP), Protease inhibitor WAP3, SKALPELAFIN, Skin-derived antileukoproteinase, trappin-2, WAP four-disulfide core domain 14, WAP3MGC13613, WFDC14elafin
Gene Symbols PI3
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Immunology
Primary or Secondary Primary
Gene ID (Entrez) 5266
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.